Protein Info for Atu2030 in Agrobacterium fabrum C58

Annotation: ECF family sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 PF22029: PhyR_sigma2" amino acids 22 to 72 (51 residues), 45.7 bits, see alignment E=1.3e-15 PF04542: Sigma70_r2" amino acids 23 to 85 (63 residues), 40.5 bits, see alignment E=5e-14 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 25 to 166 (142 residues), 77 bits, see alignment E=6.5e-26 PF07638: Sigma70_ECF" amino acids 104 to 167 (64 residues), 23.3 bits, see alignment E=1.3e-08 PF08281: Sigma70_r4_2" amino acids 110 to 162 (53 residues), 58.1 bits, see alignment E=1.3e-19 PF04545: Sigma70_r4" amino acids 115 to 164 (50 residues), 42.9 bits, see alignment E=6.9e-15

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to atu:Atu2030)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CY14 at UniProt or InterPro

Protein Sequence (178 amino acids)

>Atu2030 ECF family sigma factor (Agrobacterium fabrum C58)
MNGEKRGSHSPATGSFETEMLALIPMLRRYSRSLSRSDADGEDLLQDCVEKALANKRQWR
GTGLKTWAYTIMTNLYRNRHRAEKRHPSESLDGHETIAIPDTLSDTLENDRLHRALALLS
PDMRAVLMLVTVEGYSYQEAAETLAIPLGTVMSRLSRARETLRQHLAEDNIIPLRRPR