Protein Info for Atu1982 in Agrobacterium fabrum C58

Annotation: sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 20 to 178 (159 residues), 89.2 bits, see alignment E=1.2e-29 PF04542: Sigma70_r2" amino acids 24 to 91 (68 residues), 60.9 bits, see alignment E=1.6e-20 PF08281: Sigma70_r4_2" amino acids 122 to 174 (53 residues), 39.4 bits, see alignment E=7.9e-14 PF04545: Sigma70_r4" amino acids 128 to 176 (49 residues), 27.9 bits, see alignment E=2.8e-10

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to atu:Atu1982)

Predicted SEED Role

"RNA polymerase sigma-70 factor" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CY53 at UniProt or InterPro

Protein Sequence (180 amino acids)

>Atu1982 sigma factor (Agrobacterium fabrum C58)
MQGTEIATLINRVGMGDRSAFVSLYQATSPKLFAICLKILRDRTEAEEALQEIYIKVWQR
ARTFAVSAGKPATWLATIARNHAIDTIRARKPASDDIDEAYDLVDESIRDPEQQVVLVDE
GRRIDDCMRELETVHAQAVRRAYVEGLSYLELSDELRVPLNTVRTWLRRSLLKLRECMQR