Protein Info for Atu1974 in Agrobacterium fabrum C58

Annotation: cyclopropane-fatty-acyl-phospholipid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF02353: CMAS" amino acids 62 to 298 (237 residues), 134.2 bits, see alignment E=2.3e-42 PF03848: TehB" amino acids 102 to 198 (97 residues), 21.2 bits, see alignment E=6.9e-08 PF05175: MTS" amino acids 103 to 219 (117 residues), 26.4 bits, see alignment E=2e-09 PF13489: Methyltransf_23" amino acids 106 to 232 (127 residues), 49.8 bits, see alignment E=1.3e-16 PF13847: Methyltransf_31" amino acids 116 to 222 (107 residues), 46.7 bits, see alignment E=1.2e-15 PF13649: Methyltransf_25" amino acids 120 to 214 (95 residues), 51.3 bits, see alignment E=6.5e-17 PF08242: Methyltransf_12" amino acids 121 to 216 (96 residues), 38.8 bits, see alignment E=5.1e-13 PF08241: Methyltransf_11" amino acids 121 to 218 (98 residues), 43.6 bits, see alignment E=1.6e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1974)

MetaCyc: 42% identical to phenylalkylamine N-methyltransferase (Ephedra sinica)
2.1.1.M76 [EC: 2.1.1.M76]; 2.1.1.M76 [EC: 2.1.1.M76]; 2.1.1.M76 [EC: 2.1.1.M76]; 2.1.1.M76 [EC: 2.1.1.M76]; 2.1.1.M76 [EC: 2.1.1.M76]

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase-like protein, clusters with FIG005069"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.M76

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIF7 at UniProt or InterPro

Protein Sequence (341 amino acids)

>Atu1974 cyclopropane-fatty-acyl-phospholipid synthase (Agrobacterium fabrum C58)
MNMLAFAINAAERAPLNDGVTLAGIDMLCARTKRRLAIIPADAELAFVKDMAMFPIASHT
DEANRQHYEVPAEFFSLVLGAQRKYSSCYYPDDTTTLDEAETTALSETVAHAGLLDGMDI
LELGCGWGSLSLYMAGCFPNARITSVSNSASQRDYIIGCARERGFSNLSVVTVDMNDFTT
ANRFDRVVSVEMFEHMSNWQSLFERVRSWLQPEGRFFLHVFNHRDRSYRFDHNNPADWIA
QHFFTGGIMPAFDLPHRFGEIFTVEQDWRWSGLHYRRTALDWLANFDREIDRIRPILKRV
YGNDARLWERRWRLFFLATAGLFGHQGGEVWGVGHYLLAPT