Protein Info for Atu1967 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details TIGR03717: integral membrane protein, YjbE family" amino acids 11 to 196 (186 residues), 222.3 bits, see alignment E=1.8e-70 PF03741: TerC" amino acids 14 to 196 (183 residues), 154.7 bits, see alignment E=1.1e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1967)

Predicted SEED Role

"Integral membrane protein TerC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CY65 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Atu1967 hypothetical protein (Agrobacterium fabrum C58)
MEIFTAAGFTAFLQVIAIDLVLAGDNAIVIGLAAAGLPAHLRRKAILVGIIAATVLRIGF
AAVTVQLLAIGGLQLFGGLMLAWVCWKMWTELREAAGSIEDEVTDEEADLTKGHKTFFQA
ATQIVIADVSMSLDNVLAVAGAAQEHVTVLIIGLIVSIALMGLAANFVAKLLHRYRWISY
LGLIVIIYVALNMLYHGTLEVLPYIQSYLG