Protein Info for Atu1949 in Agrobacterium fabrum C58

Annotation: translation elongation factor G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 699 TIGR00484: translation elongation factor G" amino acids 1 to 694 (694 residues), 1113.2 bits, see alignment E=0 PF00009: GTP_EFTU" amino acids 9 to 286 (278 residues), 216.7 bits, see alignment E=5.2e-68 TIGR00231: small GTP-binding protein domain" amino acids 10 to 185 (176 residues), 123.7 bits, see alignment E=6.4e-40 PF03144: GTP_EFTU_D2" amino acids 328 to 395 (68 residues), 65.3 bits, see alignment E=1.4e-21 PF14492: EFG_III" amino acids 408 to 481 (74 residues), 116.7 bits, see alignment E=9.4e-38 PF03764: EFG_IV" amino acids 483 to 601 (119 residues), 157 bits, see alignment E=4.6e-50 PF00679: EFG_C" amino acids 604 to 690 (87 residues), 104.5 bits, see alignment E=6.5e-34

Best Hits

Swiss-Prot: 100% identical to EFG_AGRFC: Elongation factor G (fusA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02355, elongation factor G (inferred from 100% identity to atu:Atu1949)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UE15 at UniProt or InterPro

Protein Sequence (699 amino acids)

>Atu1949 translation elongation factor G (Agrobacterium fabrum C58)
MAREYKIEDYRNFGIMAHIDAGKTTTTERILYYTGKSHKIGEVHDGAATMDWMEQEQERG
ITITSAATTTFWKGRDGKMRRFNIIDTPGHVDFTIEVERSLRVLDGAIALLDANAGVEPQ
TETVWRQAEKYNVPRMIFCNKMDKTGADFYRSVEMIKTRLGATAVVMQLPIGAETEFKGV
IDLIEMNALIWRDESLGAQWDVVEIPDDLKAKADEYREKLIETVVEIDEEAMEDYLNGIM
PDNDKIRALVRRGTIDVKFHPMFCGTAFKNKGVQPLLDAVVDYLPSPLDIPAIKGIDFKT
EAEIERHADDSEPLSMLAFKIMNDPFVGSLTFARIYSGKLEKGTSVINTVKDKRERVGRM
LQMHSNSREDIEEAFAGDIVALAGLKETTTGDTLCDPLKPVILERMEFPEPVIQIAIEPK
TKGDQEKMGLALNRLAAEDPSFRVKTDEESGQTIIAGMGELHLDILVDRMRREFKVEATV
GAPQVAYRETITRQHEEDYTHKKQSGGTGQFARVKIIFEPNPEGEDFKFESKIVGGAVPK
EYIPGVQKGIESVLSSGPLAGFPMLGVKATLIDGAYHDVDSSVLAFEIASRACFREAAKK
AGAQLLEPMMKVEVVTPEDYVGDVIGDLNSRRGQIQGQESRGITIVISAHVPLANMFKYV
DNLRSMSQGRAQYSMTFDHYSPVPSNVAQEIQAKYSGQK