Protein Info for Atu1948 in Agrobacterium fabrum C58

Annotation: elongation factor TU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 TIGR00485: translation elongation factor Tu" amino acids 1 to 391 (391 residues), 728.7 bits, see alignment E=1.4e-223 PF00009: GTP_EFTU" amino acids 10 to 198 (189 residues), 207.6 bits, see alignment E=2e-65 TIGR00231: small GTP-binding protein domain" amino acids 13 to 144 (132 residues), 55.2 bits, see alignment E=7.1e-19 PF03144: GTP_EFTU_D2" amino acids 222 to 291 (70 residues), 65.4 bits, see alignment E=7.8e-22 PF03143: GTP_EFTU_D3" amino acids 295 to 389 (95 residues), 133.4 bits, see alignment E=5.8e-43

Best Hits

Swiss-Prot: 100% identical to EFTU_AGRFC: Elongation factor Tu (tufA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02358, elongation factor Tu (inferred from 100% identity to agr:AGROH133_07157)

Predicted SEED Role

"Translation elongation factor Tu" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UE16 at UniProt or InterPro

Protein Sequence (391 amino acids)

>Atu1948 elongation factor TU (Agrobacterium fabrum C58)
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPARHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYDFPGDDIPIIKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALVRGVTRDGVERGQILCKPGSVKPHK
KFMAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVSLPEGTEMVMPGDNVTVEVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE