Protein Info for Atu1893 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 67 to 84 (18 residues), see Phobius details TIGR02281: clan AA aspartic protease, TIGR02281 family" amino acids 114 to 233 (120 residues), 139.5 bits, see alignment E=3.1e-45 PF13650: Asp_protease_2" amino acids 128 to 216 (89 residues), 87.1 bits, see alignment E=1.1e-28 PF13975: gag-asp_proteas" amino acids 128 to 218 (91 residues), 90 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 60% identical to YCBV_SINSX: Uncharacterized protein in cobV 5'region from Sinorhizobium sp.

KEGG orthology group: K06985, aspartyl protease family protein (inferred from 100% identity to atu:Atu1893)

Predicted SEED Role

"CblY, a non-orthologous displasment for Alpha-ribazole-5'-phosphate phosphatase" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIH4 at UniProt or InterPro

Protein Sequence (235 amino acids)

>Atu1893 hypothetical protein (Agrobacterium fabrum C58)
MNRLTIVLLILAVGLGLLLINHDGGRTLGIDNDQFAQALYLVPIAGLLSVGILAGRRGGF
GTVIRQLAVWLVIILGLVSLYLYRYDLQSFGDRLLSGLMPGRAVVVTTAGGEQEIVLHKS
MSGHFEANVGVNGKTIHMLVDTGASSVVLANADAAEIGIDTGSLRYTVPVMTANGRTAAA
PVTLSEIGIGPIMRRNIPALVAQDGQLGQSLLGMSFLSTLGSLQMQTDELRLRDR