Protein Info for Atu1883 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF00515: TPR_1" amino acids 16 to 45 (30 residues), 28.7 bits, see alignment (E = 3.5e-10) PF07719: TPR_2" amino acids 16 to 45 (30 residues), 27.6 bits, see alignment (E = 8.4e-10) PF05175: MTS" amino acids 101 to 176 (76 residues), 23.3 bits, see alignment E=1.8e-08 PF13489: Methyltransf_23" amino acids 106 to 250 (145 residues), 55 bits, see alignment E=3.3e-18 PF13847: Methyltransf_31" amino acids 111 to 218 (108 residues), 45.2 bits, see alignment E=3.2e-15 PF13649: Methyltransf_25" amino acids 113 to 202 (90 residues), 45.7 bits, see alignment E=3.6e-15 PF08242: Methyltransf_12" amino acids 113 to 204 (92 residues), 48.3 bits, see alignment E=5.5e-16 PF08241: Methyltransf_11" amino acids 113 to 206 (94 residues), 46.6 bits, see alignment E=1.8e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1883)

Predicted SEED Role

"3-DEMETHYLUBIQUINONE-9 3-METHYLTRANSFERASE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CII0 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Atu1883 hypothetical protein (Agrobacterium fabrum C58)
MTKNQKIDEEALAEAYNRALALEKAGDVDAAVKAYEEVLAIDPDDHGGAAVRIAAMGRGE
QPSKAPDAYVETLFDQHAEAFEDILVEQLGYAVPMMVRQRLQTLNLGPFKRLLDLGCGTG
LTGEALRDMADDITGIDISENMVEIAHEKDLYETLYVAEAEDFLEDNDDEPFDIITATDV
LPYLGALEPLFFGAAENLNAGGLLIFSSETLPADIMAGRPYMVGPHQRFAHAETYVRDRL
AATGFEVVEVTDINVRMQDGNPTPGHLVIAKLKG