Protein Info for Atu1881 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (amino acid)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 66 to 90 (25 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 244 to 266 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 61 to 166 (106 residues), 71.7 bits, see alignment E=3e-24 PF00528: BPD_transp_1" amino acids 84 to 270 (187 residues), 75.9 bits, see alignment E=1.7e-25

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to atu:Atu1881)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CII1 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Atu1881 ABC transporter, membrane spanning protein (amino acid) (Agrobacterium fabrum C58)
MSHIQELIPPRPAPVVADKPLNLSRVVGIAVITLWLLLAAGLIFAMIEGWDWDKFQRYGP
RYIDGLITTITLVGSSIILGAILSVPIAFARMSENRIIGAFAYAYVYVFRSTPLLAQLFL
IYYGLGSFRPALEAVDLWWFFREAWYCGLLSLTLNTAAYQAEILRGAIRSVPRGQHEGAA
SLGISKFITFRKVILPQALIVALRPYGNEIILMIKGSAVVSIVTVFDLMGQTRYAFSRTF
DYQAYLWAAIFYLTIVETLRHIWAWLEARLTRHLKR