Protein Info for Atu1880 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (amino acid)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 55 to 78 (24 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 131 to 157 (27 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 49 to 153 (105 residues), 47.8 bits, see alignment E=8.3e-17 PF00528: BPD_transp_1" amino acids 67 to 254 (188 residues), 58.7 bits, see alignment E=3.2e-20

Best Hits

Swiss-Prot: 40% identical to NOCQ_AGRFC: Nopaline transport system permease protein NocQ (nocQ) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to atu:Atu1880)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CII2 at UniProt or InterPro

Protein Sequence (267 amino acids)

>Atu1880 ABC transporter, membrane spanning protein (amino acid) (Agrobacterium fabrum C58)
MSGAFSAIGAFWTYVSTLLDPFCGPVGLFSLFGNGTLVACGDAGWGDEIAFGVKVTISLA
LATLPVGLLIGFLIALAAQSEEKSLRLAAGIYTTIFRGLPELLTLFIVYYGVQMLLQSVA
GYVGFSGPVEINAFVAGMLALSVVFSSYASEVLLSAFKAIPKGQYEAGDALGLSRSRTMV
LIIIPQLVRIALPGMTNLWVILLKDTSYVSIIGLADIIRQTGIAARVSKEAFFFYGIACL
LYLILALISSVGIGFIDRWSRKSEARR