Protein Info for Atu1877 in Agrobacterium fabrum C58

Annotation: OmpA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 746 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF00691: OmpA" amino acids 631 to 729 (99 residues), 64.8 bits, see alignment E=3.8e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1877)

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CII4 at UniProt or InterPro

Protein Sequence (746 amino acids)

>Atu1877 OmpA family protein (Agrobacterium fabrum C58)
MLKKKNTLLTGVVFPLMSLAIAVEPAAAGFAGAARAQAPISQTLPGQVILAQAEPAQESP
EEELRKKRKQAEEAQPQAEPKREERAPEPQREPEPKREAAPAEPRPEPKREAPPEPQQRE
ARPEPAPAPAEQPQERPRKPERAQEPQGEGEQRPARQREAAPEAAPAEQQPQERPRKPQK
AEQPAGEGEQRPERPRKEKEPAKEPAAEQQPAARPENAEQPAKPREPAPGKKPQVEEKAP
EQKAEPAEKPVPEKKPAAPEPAAKEAPVPTEAPTPARPPAPEAQPNPAPGRQPSEQPPVK
SEPAAPLPGAPTPPPSGATTGQAPAGEAVPSQVAVPQTEAPPTTKEELDKAKAIAKDPSK
TADTVILPVDKGAAVLDSDKEVERSGNRQTREERRREREQAGDVKVPTSDAEAQRAGAAE
GKAPPPPVKLEAITSQQGERIDRRPQYERPDGVREWQPREGRPRDRDMDAPIILQFGDRV
VVRGDDNQRFIRDGGEPYYERLPGGRVRETVERRDGTQVVTIRNRYGDVMQRSRIDDRGR
EYVLFYAPELMDDPDRDYVYRDPGLDLPPMRLRIPVTDYIIDTSSDPDRDYYRFLEQPPV
EPVERVYSLDEVRYSARIRDKVRRIDLDTITFATGSADIPMAQARSLRKVADAINKALQK
NPAETFLIEGHTDAVGSDESNLVLSDERAASVANVLTDVYGIPPENLATQGYGERYLKVQ
TLGPEQQNRRVTIRRVTPLVKPIAQN