Protein Info for Atu1863 in Agrobacterium fabrum C58

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 115 to 132 (18 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details PF00892: EamA" amino acids 6 to 131 (126 residues), 71.3 bits, see alignment E=5e-24 amino acids 142 to 280 (139 residues), 50 bits, see alignment E=2e-17

Best Hits

Swiss-Prot: 45% identical to EAMA_SALTY: Probable amino-acid metabolite efflux pump (eamA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03298, drug/metabolite transporter, DME family (inferred from 100% identity to atu:Atu1863)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CYC8 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Atu1863 permease (Agrobacterium fabrum C58)
MALPHIFLALITVFLWGFNFVAIKVGVADMPPLFLTGVRYLFAAVPLVFFLPKPNVPWRH
MIVYGMAMGFFQFGLLYPAIKLGLPAGLASLVMQSQAFFTLALAVVFLGERPLPSQIAGA
IVAFGGLAVIGMERMTAAALIPLLMGVGSAIAWACGNIVNRRIGQVNVVSFIAWTSLVPV
LPLVLLSLVVEGPDAIVEGLQNATPTMALVVIYMAYGATIVGAGIWSYLLLRYPAGTVAP
FSLLVPIVGFISAYLAFAEHITIFEIIGAALVILGLALNVFGRRIGVSRFWVRSPQG