Protein Info for Atu1861 in Agrobacterium fabrum C58

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 86 to 103 (18 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 209 to 233 (25 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details TIGR03718: integral membrane protein, TerC family" amino acids 12 to 321 (310 residues), 415.1 bits, see alignment E=9.9e-129 PF03741: TerC" amino acids 78 to 286 (209 residues), 183.4 bits, see alignment E=1.8e-58

Best Hits

Swiss-Prot: 48% identical to Y082_RICBR: Uncharacterized membrane protein RBE_0082 (RBE_0082) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K05794, tellurite resistance protein TerC (inferred from 100% identity to atu:Atu1861)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIJ0 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Atu1861 transporter (Agrobacterium fabrum C58)
MEFLLNDFLGTPTWMWAVFISLVLGLLALDLGVLHKNSKEIGIRESLLMSGFYIAIGLAF
GGWIWYQSGQQSAMEYVTGFVVEKSLAMDNIFIIAMIFSYFAIPRQYQHRVLLWGILGVI
VLRGIMIAGGAAIVENFHWVLYLFAAFLVFTGLKMLFSSDHDENDIGNNRILKFLRSRLP
VTEKPHGEKFFVKETDATTGKLKTFVTPLFLALIMVEIADLIFAVDSIPAIFAITTDPFI
VYTSNIFAILGLRALYFALAALIHRFAYLKYALAAVLVFVGSKIFVADMLGIAKIPPAVS
LGVTVAILATGIIGSLVATRKEAKAIE