Protein Info for Atu1854 in Agrobacterium fabrum C58

Annotation: glutaredoxin-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 TIGR00365: monothiol glutaredoxin, Grx4 family" amino acids 5 to 101 (97 residues), 157.3 bits, see alignment E=4.7e-51 PF00462: Glutaredoxin" amino acids 17 to 81 (65 residues), 72.9 bits, see alignment E=1e-24

Best Hits

Swiss-Prot: 62% identical to YC64L_SYNY3: Uncharacterized monothiol glutaredoxin ycf64-like (slr1846) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K07390, monothiol glutaredoxin (inferred from 100% identity to atu:Atu1854)

Predicted SEED Role

"Uncharacterized monothiol glutaredoxin ycf64-like" in subsystem Glutaredoxins or Glutathione: Redox cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CYD6 at UniProt or InterPro

Protein Sequence (111 amino acids)

>Atu1854 glutaredoxin-related protein (Agrobacterium fabrum C58)
MSGIHDIIDSEVKSNDIVLFLKGTPQFPQCGFSGQVVQILDYLGVEYKGVNVLADADIRQ
GIKDYSNWPTIPQLYIKGEFVGGCDIVKEMFQSGELQSHFQEQGISVRGAA