Protein Info for Atu1821 in Agrobacterium fabrum C58

Annotation: cysteine desulfurase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01979: cysteine desulfurase, SufS family
  • amino acids 9 to 407 (399 residues), 591.2 bits, E=4.7e-182
• PF00266: Aminotran_5
  • amino acids 27 to 396 (370 residues), 481.7 bits, E=3e-148
• PF00155: Aminotran_1_2
  • amino acids 67 to 202 (136 residues), 36.3 bits, E=8e-13
• PF01041: DegT_DnrJ_EryC1
  • amino acids 87 to 206 (120 residues), 28.3 bits, E=2.1e-10
• PF01212: Beta_elim_lyase
  • amino acids 88 to 243 (156 residues), 29.9 bits, E=7.4e-11

Best Hits

Swiss-Prot: 50% identical to CSD_BACHD: Probable cysteine desulfurase (csd) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K11717, cysteine desulfurase / selenocysteine lyase [EC: 2.8.1.7 4.4.1.16] (inferred from 100% identity to atu:Atu1821)

MetaCyc: 49% identical to L-cysteine desulfurase (Escherichia coli K-12 substr. MG1655)
Selenocysteine lyase. [EC: 4.4.1.16]; Cysteine desulfurase. [EC: 4.4.1.16, 2.8.1.7]

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7), SufS subfamily" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

• superpathway of L-alanine biosynthesis (4/4 steps found)
• L-alanine biosynthesis III (1/1 steps found)
• L-cysteine degradation IV (1/1 steps found)
• cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
• superpathway of thiamine diphosphate biosynthesis II (7/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (4/7 steps found)
• bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
• tRNA-uridine 2-thiolation (thermophilic bacteria) (2/5 steps found)
• tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
• tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
• superpathway of thiamine diphosphate biosynthesis I (5/10 steps found)
• molybdopterin biosynthesis (2/6 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (2/6 steps found)
• tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)
• [2Fe-2S] iron-sulfur cluster biosynthesis (2/10 steps found)
• tRNA-uridine 2-thiolation and selenation (bacteria) (2/11 steps found)

KEGG Metabolic Maps

• Selenoamino acid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7 or 4.4.1.16

Sequence Analysis Tools

See Q7CYG4 at UniProt or InterPro

Protein Sequence (408 amino acids)

>Atu1821 cysteine desulfurase (Agrobacterium fabrum C58)
MAAPYDVEAVRKDFPILSREVYGKPLTYLDNGASAQKPQVVIDAVSHAYSNEYANVHRGL
HFLSNAATDAYEAAREKVRRFLNAGSVDEIVFTKSSTEAINTVAYGYGMPVIGEGDEIVI
SIMEHHSNIVPWHFIRERQGAKLVWVPVDDDGAFHIEAFEKSLTERTKLVAITHMSNALG
TILPVKEICRIAHERGIPVLVDGSQGAVHMPVDVRDIDCDWYVMTGHKLYGPSGIGVLYG
KTERLREMRPFQGGGEMILDVSEDNVTYNEPPHRFEAGTPPIVQAIGLGYALDYMDNLGR
AAIAAHEADLAAYAATRLREVNSLRIIGNAPDKGGIFSFELEGIHAHDVSMVIDRRGVAV
RAGTHCAMPLLKRFGVTSTCRASFGLYNTRAEVDRLVEALDYARKFFA