Protein Info for Atu1816 in Agrobacterium fabrum C58
Annotation: ABC transporter, nucleotide binding/ATPase protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 52% identical to Y796_METJA: Uncharacterized ABC transporter ATP-binding protein MJ0796 (MJ0796) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: K02003, (no description) (inferred from 100% identity to atu:Atu1816)MetaCyc: 44% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427
Predicted SEED Role
"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)
MetaCyc Pathways
- lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)
Isozymes
Compare fitness of predicted isozymes for: 3.6.3.-
Use Curated BLAST to search for 3.6.3.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A9CIL1 at UniProt or InterPro
Protein Sequence (239 amino acids)
>Atu1816 ABC transporter, nucleotide binding/ATPase protein (Agrobacterium fabrum C58) MQQPPLIEFRNVVKQYGRGEATIRALDGVSLSIREKEFVAIMGPSGSGKSTSMNIIGCLD VPTAGEYLFQGVPTSGFDNEHLTLLRRHMLGFVFQGFNLLSRTSAVENVELPLVYRGMKA SERRARAMEALAQVGLKGREDHTTQELSGGQQQRVAIARAIVTRPALLLADEPTGNLDTK TSNEIMELITALNRDRGITVVMVTHEEDIAAHAGRLLRFVDGHLASDSAADEKETSDVL