Protein Info for Atu1815 in Agrobacterium fabrum C58

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 36 to 54 (19 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 69 to 348 (280 residues), 159.6 bits, see alignment E=4.6e-51 PF16576: HlyD_D23" amino acids 80 to 324 (245 residues), 64.3 bits, see alignment E=1.5e-21 PF13533: Biotin_lipoyl_2" amino acids 90 to 138 (49 residues), 42.9 bits, see alignment 4.9e-15 PF13437: HlyD_3" amino acids 214 to 321 (108 residues), 50.9 bits, see alignment E=3.4e-17

Best Hits

KEGG orthology group: K02005, HlyD family secretion protein (inferred from 100% identity to atu:Atu1815)

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CYG9 at UniProt or InterPro

Protein Sequence (432 amino acids)

>Atu1815 HlyD family secretion protein (Agrobacterium fabrum C58)
MNDANGNGRDTPDSQPDLREILGTNRNGRKKKSRRFLYIAAAIVLIGGGLGYYYQSRAAG
VAYNYTTEPARQGDLSVIVTSTGSVQPTDQVDISSELSGTVRKVNVTYNTPVKSGDILAE
LDTNKLEADVQSARAKLASAKANVLKARADLGSAKTSMERLRSLVQSRVSSQQDLDAAQF
THDAAAATLQVNEATVLSAEADLRLAEVNLGKAKIVSPIDGVILTRSVDPGATVASSLNA
PVLFTIAGDLRHMELQVSVDEADVGKVETGQKATFNVDAYPDRSFPAEIETVRFASETVS
NVVTYKGILTVDNAELLLRPGMTATANIIVEEIKDTLLVPNSALRYTPPRESASRGGGLM
SLFRPPRMGRSQNRDAGQAATGKRTVWVLRNNAPVAVAIETGSTDGQHTVVKSGELKADD
QVITDATTRNAG