Protein Info for Atu1808 in Agrobacterium fabrum C58

Annotation: UDP-glucose:ceramide glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13641: Glyco_tranf_2_3
  • amino acids 41 to 268 (228 residues), 48 bits, E=1.5e-16
• PF13506: Glyco_transf_21
  • amino acids 96 to 268 (173 residues), 189.7 bits, E=3.1e-60

Best Hits

KEGG orthology group: K00720, ceramide glucosyltransferase [EC: 2.4.1.80] (inferred from 100% identity to atu:Atu1808)

Predicted SEED Role

"Ceramide glucosyltransferase"

MetaCyc Pathways

• lacto-series glycosphingolipids biosynthesis (1/7 steps found)
• globo-series glycosphingolipids biosynthesis (1/8 steps found)
• neolacto-series glycosphingolipids biosynthesis (1/12 steps found)
• sphingolipid biosynthesis (plants) (1/13 steps found)
• ganglio-series glycosphingolipids biosynthesis (1/22 steps found)
• superpathway of glycosphingolipids biosynthesis (1/42 steps found)

KEGG Metabolic Maps

• Sphingolipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.80

Sequence Analysis Tools

See Q7CYH2 at UniProt or InterPro

Protein Sequence (380 amino acids)

>Atu1808 UDP-glucose:ceramide glycosyltransferase (Agrobacterium fabrum C58)
METVFALCAIMLLAFNLLGIVLAGWRLTRRDAENDLVRQKPPVSLVVPLRGVENFTPLTL
SRAFGLDWPDYELLFCVADEFDPVIAEVRKAAAAFPSVSMQLLIGDDRVSANPKLNNCVK
GWRAAKYEWVILADSNVLMPKSYIATMMSAWRPDSGLVCSPPLGSRPVGFWANVECAFLN
GSQGRWQYAAEAIGIGFAQGKSMLWNKPFLEDRGGIRALAAEIAEDAASTKLVRSAGRKV
HLVSAPFEQPLGQRHAGEIWSRQTRWARLRRVTFPQYFAPEILTGALPPLLFALAATAMM
DVNLAATASVVLALMFGPELALAALNGWPVSLYTLPAMIARDLIMPVVWARSWIGSAVAW
RGNVMTIGTAESTLAGPPAE