Protein Info for Atu1790 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (sugar)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 54 (23 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 142 to 159 (18 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 218 to 235 (18 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 268 to 285 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 280 (272 residues), 135.8 bits, see alignment E=8e-44

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to atu:Atu1790)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIM6 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Atu1790 ABC transporter, membrane spanning protein (sugar) (Agrobacterium fabrum C58)
MMDMLQAILLTVITAATPLVIAASGELVAERSGVLNLGVEGMMIMGAVCAFAATHMTGSP
YLGILAGIASGAVFSLLFGFLTLTLVTNQVATGLALTILGLGVSGMLGESFVGLPGIKLQ
PIVFPVLSEIPFIGPLLFRQDLIFYMSIALVFGISWFLFKSRAGLKIRAIGDNHASAHAL
GINVIRTRYLAVMFGGACAGLAGAQLSLVYTPQWVENMSAGRGWIALALVVFASWRPWRL
LAGGYLFGAVTIGQLHAQAFGIGVPSQLLSALPYLATIVVLVIISHNRRTTLINTPASLG
KSFVPDR