Protein Info for Atu1780 in Agrobacterium fabrum C58

Annotation: ATP-dependent DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 701 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF17191: RecG_wedge" amino acids 18 to 181 (164 residues), 36 bits, see alignment E=1.9e-12 TIGR00643: ATP-dependent DNA helicase RecG" amino acids 41 to 664 (624 residues), 672.9 bits, see alignment E=2.8e-206 PF01336: tRNA_anti-codon" amino acids 70 to 145 (76 residues), 36.9 bits, see alignment E=9.6e-13 PF04851: ResIII" amino acids 273 to 431 (159 residues), 44.3 bits, see alignment E=6.6e-15 PF00270: DEAD" amino acids 276 to 435 (160 residues), 86.8 bits, see alignment E=5.1e-28 PF00176: SNF2-rel_dom" amino acids 298 to 436 (139 residues), 25.9 bits, see alignment E=1.8e-09 PF00271: Helicase_C" amino acids 475 to 586 (112 residues), 61.5 bits, see alignment E=3e-20 PF19833: RecG_dom3_C" amino acids 616 to 680 (65 residues), 45.2 bits, see alignment E=2.8e-15

Best Hits

KEGG orthology group: K03655, ATP-dependent DNA helicase RecG [EC: 3.6.4.12] (inferred from 100% identity to atu:Atu1780)

Predicted SEED Role

"ATP-dependent DNA helicase RecG (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CYJ6 at UniProt or InterPro

Protein Sequence (701 amino acids)

>Atu1780 ATP-dependent DNA helicase (Agrobacterium fabrum C58)
MRPAILDPLFASVSTLAGVGPKLADLLAKLLSRESADDTRVIDLLFHAPSNVIDRRNRPG
IALAAPGAIVTIQGRVDRHQPPPAGNRSAPYRVFLHDETGELALTFFRAKGDWLSKALPV
DEEVLVSGKVDWFNGRASMVHPDFMVKLSEAENLPLVEAVYPMTAGLSPKVLRRAIEGGL
SKLPVFPEWIDETLKTRQGFGDVASSFRELHDPRDSADIDPQAPARRRLAYDEFLAGQLS
LALVRQRLRKVAGQPIRARGDIAAKILSQLPFSLTASQSAAVKDILTDMAGEDRMLRLLQ
GDVGAGKTLVALMAMATAVEAGGQAVLMAPTEILARQHFATISKLAKAVGLTVEVLTGRT
KGKERREIEERVASGEAQIVIGTHALFQDSVSYKNLVLAVVDEQHRFGVHQRLRLTAKGI
TPHMLVMTATPIPRTLVLAAFGDMDVSKLTEKPAGRKPIQTVTIPTERIGDIVERLRAAL
KDGKKAYWICPLVEETEESDLMSAEERHAVLSQMLGANIGLIHGRMNGPEKDAAMLAFKS
GETRLLVATTVVEVGVDVPDATIMVIEHAERFGLAQLHQLRGRVGRGDEASTCILLYKGP
LSENGRARLSILRDSEDGFLIAEEDLKLRGEGELLGTRQSGTPGFRIASLEAHADLLEIA
RKDAAYVIERDPELTGPRGESLRTLLYLHRRDEAIRFLHAG