Protein Info for Atu1753 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 transmembrane" amino acids 26 to 49 (24 residues), see Phobius details amino acids 57 to 74 (18 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details PF01694: Rhomboid" amino acids 81 to 236 (156 residues), 74.4 bits, see alignment E=5.8e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1753)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIP3 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Atu1753 hypothetical protein (Agrobacterium fabrum C58)
MSYEDGEQPPVSETPEPKDDTNNPIFNLPGLLVGILAALAIAYVVPAYLLSEEGNGWFIF
TFGFIPLRYAVPFSQQGLEWLWTPVTYSFLHGGIEHILFNGLWLMAFGAPVLRRIGTVRF
VLLWCISAAVSAFGHAALNWGDVTVLIGASGVVSALMGAACRFAFPVRGGYSASFGHLMP
RQSILAALSNRTVLIFTLMWLFGNVLIAIGVPLFGDVGGQIAWDAHVFGFLLGFLFFSLF
DRPSR