Protein Info for Atu1749 in Agrobacterium fabrum C58

Annotation: GTP cyclohydrolase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 PF01227: GTP_cyclohydroI" amino acids 28 to 205 (178 residues), 253.9 bits, see alignment E=3.2e-80 TIGR00063: GTP cyclohydrolase I" amino acids 28 to 206 (179 residues), 221.6 bits, see alignment E=2.7e-70

Best Hits

Swiss-Prot: 100% identical to GCH1_AGRFC: GTP cyclohydrolase 1 (folE) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01495, GTP cyclohydrolase I [EC: 3.5.4.16] (inferred from 100% identity to agr:AGROH133_06710)

MetaCyc: 50% identical to GTP cyclohydrolase I (Bacillus subtilis subtilis 168)
GTP cyclohydrolase I. [EC: 3.5.4.16]

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 1" in subsystem Folate Biosynthesis or Molybdenum cofactor biosynthesis or Pterin biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UEK8 at UniProt or InterPro

Protein Sequence (208 amino acids)

>Atu1749 GTP cyclohydrolase I (Agrobacterium fabrum C58)
MDAIVKNFPGAGAKPDVAEARPSQAEAEEAVRVLLRWAGENPAREGLLDTPKRVAKAYRE
LFAGYELNVQDVLGTTFEEVGGYDDVVLVRDIPFFSHCEHHMVPIVGKAHVAYLPAGRVL
GLSKIARVVEIFGRRLQTQENMTAQIARSIEETLKPRGVAVMIDAEHMCMSMRGVNKQGS
TTLTTSFTGTFKNDPAEQVRFMTMVRNR