Protein Info for Atu1739 in Agrobacterium fabrum C58

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 24 to 48 (25 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 81 to 105 (25 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 230 to 257 (28 residues), see Phobius details amino acids 263 to 292 (30 residues), see Phobius details amino acids 296 to 313 (18 residues), see Phobius details amino acids 334 to 363 (30 residues), see Phobius details PF01594: AI-2E_transport" amino acids 36 to 366 (331 residues), 130.2 bits, see alignment E=5.1e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1739)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CYM8 at UniProt or InterPro

Protein Sequence (412 amino acids)

>Atu1739 permease (Agrobacterium fabrum C58)
MSNIDSRKQNGEPRWLGPASPTRIALIPPISAARWLLLLVVLAGIYFFNGFLVPVLAALV
IGFASWPVYTRLLRQVGGNTTLGATIAIILIIAFLVVPIFIAASYTATEIREWFGWAVHV
NKAGAPVPDWIAALPGIGPWLGEQWVKYIGTPGAIGEVIQLVSGANIGNIYRAILAAGNG
AFHLVLTLLFMLIALFFVYRNGAGFTRQIDLVGERILPTRWERISRVVPATISSTVTGMT
LIAIGEGIILGIAYWIAGVPSPVTLGVLTGVMALIPGGAPLSFTLVSIYLVASGSPAHGL
ALFVWGSVELFIVDKTIRPKLVGGPIKLPFLPTFFGLVGGVKTMGFLGLFIGPVLMALLV
AIWREWVREVEISAAVSAELPPPPPTQNDPATEAVSHEDDNDETTAFRKAAF