Protein Info for Atu1731 in Agrobacterium fabrum C58

Annotation: xanthine-guanine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00156: Pribosyltran
  • amino acids 11 to 154 (144 residues), 61.1 bits, E=4.2e-21

Best Hits

Swiss-Prot: 100% identical to XGPT_AGRFC: Xanthine phosphoribosyltransferase (gpt) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00769, xanthine phosphoribosyltransferase [EC: 2.4.2.22] (inferred from 100% identity to atu:Atu1731)

Predicted SEED Role

"Xanthine-guanine phosphoribosyltransferase (EC 2.4.2.22)" in subsystem Purine conversions (EC 2.4.2.22)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (13/14 steps found)
• guanine and guanosine salvage I (2/2 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• xanthine and xanthosine salvage (2/2 steps found)
• superpathway of guanine and guanosine salvage (2/3 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.22

Sequence Analysis Tools

See Q8UEM6 at UniProt or InterPro

Protein Sequence (165 amino acids)

>Atu1731 xanthine-guanine phosphoribosyltransferase (Agrobacterium fabrum C58)
MSLPDKAFPVSWDQFHRDARALAWRLAGLDKEFRAIVCITRGGLVPAAIISRELNIRMID
TVCIATRHDYVNQGDTVLLKGVAPELTTDAGEGVLVVDDLTDTGKTALEVREMLPRAHFA
CVYAKPKGVPTIDTFVTEVSQDTWIYFPWDMGFTYQEPIAKGSRG