Protein Info for Atu1715 in Agrobacterium fabrum C58

Annotation: exopolysaccharide production negative regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF08238: Sel1" amino acids 76 to 106 (31 residues), 19.4 bits, see alignment 6.5e-08 amino acids 158 to 193 (36 residues), 27.2 bits, see alignment 2.2e-10

Best Hits

Swiss-Prot: 74% identical to EXOR_RHIME: Exopolysaccharide production negative regulator (exoR) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K07126, (no description) (inferred from 100% identity to atu:Atu1715)

Predicted SEED Role

"Exopolysacchride production negative regulator ExoR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIQ7 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Atu1715 exopolysaccharide production negative regulator (Agrobacterium fabrum C58)
MLKCEANVLKPLLMGMLLASLAMPVLAFDINAGVTKESGPFDLFKFGFKAYKNGNKDEAV
EAYRYAAEKGHTGSRWALANMYAYGDGVAKNDLEAFKIYSEIASQGVEPGSEDTGFFVNA
LLSLADYYRHGIPGSPVKMDLSQARQLYFQVASTFGVAEAQFRLAEMILAGEGGRADVQQ
AKKWLNQARKHGHAGAMSIFGNLIFQEGQTTQGLAFMTAALDKCTVADCTWIQNLQEQAF
SLAGENDRRAAIAMAQNMQFNDPD