Protein Info for Atu1696 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 55 (19 residues), see Phobius details amino acids 67 to 91 (25 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 124 to 141 (18 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details PF00892: EamA" amino acids 8 to 140 (133 residues), 50.8 bits, see alignment E=1.1e-17 amino acids 149 to 276 (128 residues), 30.7 bits, see alignment E=1.8e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1696)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CYQ6 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Atu1696 hypothetical protein (Agrobacterium fabrum C58)
MALTDNTRGALFMALAMASFTANDALTKSVTPYINTGQIMFVRGVMTVVLIYIAARHFGA
LRPLKTLLRPIIILRCLCEVTAAVLYLTALGLIEFSNASAILQSLPLVVTLGAALFLREP
VGWRRWVAIIVGFIGVLVIIRPGPEGFTPGALLVVASLAVTAARDLLTRKMYADVPSLAI
TVITAFVNMAVGGLLIVPFGGWQPMNFTIVSHLAGSAILVLVGYQAIILSMRTGEISFVA
PFRYTGLLWGFMIGVFFFNEKIDSYTIIGAMIVIGSGLYTFYRESLRKRSQMAKRAAATP
TAATTVRPASVTKATVTEEAGE