Protein Info for Atu1693 in Agrobacterium fabrum C58

Annotation: glutathione-regulated potassium-efflux system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 602 transmembrane" amino acids 12 to 27 (16 residues), see Phobius details amino acids 35 to 53 (19 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 299 to 322 (24 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 362 to 381 (20 residues), see Phobius details TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 17 to 289 (273 residues), 269.2 bits, see alignment E=2.2e-84 PF00999: Na_H_Exchanger" amino acids 22 to 378 (357 residues), 228.3 bits, see alignment E=1.4e-71 PF02254: TrkA_N" amino acids 406 to 519 (114 residues), 79.8 bits, see alignment E=2.1e-26

Best Hits

Swiss-Prot: 51% identical to KEFX_HAEIN: Glutathione-regulated potassium-efflux system protein (kefBC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K11747, glutathione-regulated potassium-efflux system protein KefB (inferred from 100% identity to atu:Atu1693)

Predicted SEED Role

"putative Glutathione-regulated potassium-efflux system protein KefB" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIR7 at UniProt or InterPro

Protein Sequence (602 amino acids)

>Atu1693 glutathione-regulated potassium-efflux system protein (Agrobacterium fabrum C58)
MAVEANGNDLAQVVVLLAAGVIAAPIFKRIGLGSVLGYLAAGLVIGPYGLGFFSDSQAIL
HVAELGVVMFLFIIGLEMQPSRLWSMRQDIFGLGALQVLVCMGGLTLVGVSLGFPVIMSF
VAGTGFVLTSTAIVMQMLQERNSMSSLKGQRIIAILLFEDLAIVPLLALVAFLGSGGEHV
TASERWLSIGIALAAVGALILAGRYLLNPFFRLLAASGAREVMTAAALLVVLGSALLMQV
SGLSMAMGAFLAGVLLSESSFRHQLEADIEPFRGILLGLFFLGVGMAIDLAVIASNWQLV
VVSVAGYMLLKAFLIYGVARALGTTRRESLERAVLMAQGGEFAFVLYSAAVSAGILDREA
NAILTATIIISMVLTPLMVILHDRLVPAAVPNTDDLDVPENVEGSILLIGFGRFGQIVSQ
PLLARGYTLSLIDKDADFVRDAAEFGFKVYYGDGSRAEILHAAGASTARAVLICVDDKDA
AVRIAEIVKHEFPLVPVLARAYDRGHAIDLLKAGVDYQIRETLESALNFSEEVLGAMGEE
REDAARLVEEFRDRDEERFAMEVVGGIYAGRSLIRGNAQPADLVAARTARERAEREKAEA
EE