Protein Info for Atu1681 in Agrobacterium fabrum C58
Annotation: phosphopantetheine adenylyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to COAD_AGRFC: Phosphopantetheine adenylyltransferase (coaD) from Agrobacterium fabrum (strain C58 / ATCC 33970)
KEGG orthology group: K00954, pantetheine-phosphate adenylyltransferase [EC: 2.7.7.3] (inferred from 100% identity to atu:Atu1681)MetaCyc: 41% identical to pantetheine-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Pantetheine-phosphate adenylyltransferase. [EC: 2.7.7.3]
Predicted SEED Role
"Phosphopantetheine adenylyltransferase (EC 2.7.7.3)" in subsystem Coenzyme A Biosynthesis (EC 2.7.7.3)
MetaCyc Pathways
- superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
- superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
- coenzyme A biosynthesis I (bacteria) (4/4 steps found)
- coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)
- coenzyme A biosynthesis III (archaea) (3/4 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.7.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8UES4 at UniProt or InterPro
Protein Sequence (164 amino acids)
>Atu1681 phosphopantetheine adenylyltransferase (Agrobacterium fabrum C58) MTIAFYPGSFDPMTNGHLDVLIQALNVASKVIVAVGIHPGKAPLFSFDERAALISRALSE TLPGEAARVEVVSFDNLVVDAARQHGAHLLLRGLRDGTDLDYEMQMAGMNRQMAPDIQTV FLPAGTSSRPITATLVRQIAAMGGNVDAFVPKAVLEALNAKLKR