Protein Info for Atu1661 in Agrobacterium fabrum C58

Annotation: soluble pyridine nucleotide transhydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 PF07992: Pyr_redox_2" amino acids 4 to 326 (323 residues), 181.2 bits, see alignment E=1.9e-56 PF12831: FAD_oxidored" amino acids 5 to 81 (77 residues), 39.7 bits, see alignment E=2.4e-13 PF00890: FAD_binding_2" amino acids 5 to 43 (39 residues), 31 bits, see alignment 9.7e-11 PF01266: DAO" amino acids 5 to 121 (117 residues), 30.2 bits, see alignment E=2.1e-10 PF13450: NAD_binding_8" amino acids 8 to 41 (34 residues), 26 bits, see alignment 5.4e-09 PF13738: Pyr_redox_3" amino acids 124 to 310 (187 residues), 43.3 bits, see alignment E=1.8e-14 PF00070: Pyr_redox" amino acids 177 to 248 (72 residues), 63.1 bits, see alignment E=1.7e-20 PF02852: Pyr_redox_dim" amino acids 346 to 451 (106 residues), 89.3 bits, see alignment E=1.1e-28

Best Hits

Swiss-Prot: 51% identical to STHA_MYCTO: Probable soluble pyridine nucleotide transhydrogenase (sthA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00322, NAD(P) transhydrogenase [EC: 1.6.1.1] (inferred from 100% identity to atu:Atu1661)

Predicted SEED Role

"Soluble pyridine nucleotide transhydrogenase (EC 1.6.1.1)" in subsystem Phosphate metabolism (EC 1.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIS9 at UniProt or InterPro

Protein Sequence (467 amino acids)

>Atu1661 soluble pyridine nucleotide transhydrogenase (Agrobacterium fabrum C58)
MYQFDLIVVGSGPAGRRAAIQAAKLEKKVLVIEKGSRVGGVSVHTGTIPSKTLRETALNL
TGWRERGFYGRAYRVKQEIDADDLRRRLLITLDHEVEVLEHQFARNRVQHIRGTASFIDA
NTMKVVKSDGEVMTVTATSILLTIGTRPYRPPHIPFDGQAVLDSDEILEIKELPRSMVVV
GAGVIGIEYATIFSALDTQVTVVEPRETMLEFIDKEIVEDFTYQLRDRNMKLIFGQKAEK
VERDESGKCLVSLSNGRVLKAETVLFAAGRVGATDTLNLSACGLEADSRGRLKVDPETFQ
TSVPNIYAAGDIIGFPSLASTSMEQGRIAARHAVGAPAGEPPQFFPYGIYAVPEISTCGL
TEEEVVERGIPYECGIAHFRETSRGHIMGLDSGLLKMIFSLKTRRLLGVHIVGEGATELV
HIGQAVLNLKGTVEYFVENTFNYPTLAEAYKIAGLDAWNRMGELKKD