Protein Info for Atu1656 in Agrobacterium fabrum C58

Annotation: tolB protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF07676: PD40" amino acids 21 to 38 (18 residues), 14.7 bits, see alignment (E = 3.7e-06) amino acids 104 to 138 (35 residues), 28 bits, see alignment 2.5e-10 amino acids 147 to 182 (36 residues), 44.7 bits, see alignment 1.4e-15

Best Hits

Swiss-Prot: 100% identical to Y1656_AGRFC: Uncharacterized protein Atu1656 (Atu1656) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 100% identity to atu:Atu1656)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UEU8 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Atu1656 tolB protein (Agrobacterium fabrum C58)
MRSSIEIFNIRTRKMRVVWQTPELFEAPNWSPDGKYLLLNSEGLLYRLSLAGDPSPEKVD
TGFATICNNDHGISPDGALYAISDKVEFGKSAIYLLPSTGGTPRLMTKNLPSYWHGWSPD
GKSFTYCGIRDQVFDIYSMDIDSGVETRLTHGEGRNDGPDYSPDGRWIYFNSSRTGQMQI
WRVRVDGSSVERITDSAYGDWFPHPSPSGDKVVFVSYDADVFDHPRDLDVRVQLMDMDGG
NVETLFDLFGGQGTMNSPNWSPDGDEFAYVRYFPVE