Protein Info for Atu1650 in Agrobacterium fabrum C58

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 40 to 56 (17 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 175 to 191 (17 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 233 to 259 (27 residues), see Phobius details amino acids 272 to 287 (16 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 3 to 341 (339 residues), 65.8 bits, see alignment E=1.9e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1650)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIT4 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Atu1650 acyltransferase (Agrobacterium fabrum C58)
MAWWIVLGHALQLVGAGTNGFLSFVPSKIMNLILDGGPPVDVFIIISGFVITHLMINKQE
SYVPYITRRAFRIFPIYLVTLFIAIATIDLYQAAWVEYPFALNRDMRIARFDEQQGQFWT
HLGLHLTMLHGIVPDNLLPFSSTSILSPAWSLSLEWQFYLVAPFLITLLIRNMNFALLGA
LLLLGMQWLVAHQQVFEWQYNGFLPKIISYFVIGILSRLVLEKMYRKQVYLDVVLITAFL
LLFVPTWVALIWIVFFALAAYESKLTDLNIPILRHFGALVAFNGVVAKMGSWSYSTYLIH
IPVFSVVLGLYVRTVGVENVSQTYALLLLLASFPVIVLLSWTLYNTIEDPFRKLGSQIAK
RKAPPSAAVTEPRA