Protein Info for Atu1613 in Agrobacterium fabrum C58

Annotation: ribose 5-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 TIGR00021: ribose 5-phosphate isomerase A" amino acids 2 to 220 (219 residues), 260.5 bits, see alignment E=5.3e-82 PF06026: Rib_5-P_isom_A" amino acids 46 to 219 (174 residues), 204.8 bits, see alignment E=3.9e-65

Best Hits

Swiss-Prot: 100% identical to RPIA_AGRFC: Ribose-5-phosphate isomerase A (rpiA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 100% identity to atu:Atu1613)

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UEZ0 at UniProt or InterPro

Protein Sequence (226 amino acids)

>Atu1613 ribose 5-phosphate isomerase (Agrobacterium fabrum C58)
MKIKAAEAALSHVQDGMRLGIGTGSTAEEFVRLLAEKVAAGLKVEGVPTSERTARLCVEL
GVPLKSLDELPELDLTIDGADEVDHVLRLVKGGGGALLREKIVAAASGRMIVIADQSKVV
ETLGAFPLPIEINPFGQVATRIAIEKLAARSGLSGELTMRSSGDGAFMTDGGHLILDASF
GRIPDAEALARELNTIPGVVEHGLFINLASLAIIAGPEGARMMQAV