Protein Info for Atu1611 in Agrobacterium fabrum C58

Annotation: glutathione reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 TIGR01424: glutathione-disulfide reductase" amino acids 4 to 450 (447 residues), 728.8 bits, see alignment E=1e-223 PF07992: Pyr_redox_2" amino acids 6 to 321 (316 residues), 217.5 bits, see alignment E=5.6e-68 PF13738: Pyr_redox_3" amino acids 122 to 305 (184 residues), 39 bits, see alignment E=1.2e-13 PF00070: Pyr_redox" amino acids 173 to 245 (73 residues), 70 bits, see alignment E=4e-23 PF02852: Pyr_redox_dim" amino acids 341 to 449 (109 residues), 112.8 bits, see alignment E=1.9e-36

Best Hits

Swiss-Prot: 49% identical to GSHR_PSEAE: Glutathione reductase (gor) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00383, glutathione reductase (NADPH) [EC: 1.8.1.7] (inferred from 100% identity to atu:Atu1611)

MetaCyc: 38% identical to glutathione reductase (NADPH) (Escherichia coli K-12 substr. MG1655)
Glutathione-disulfide reductase. [EC: 1.8.1.7]

Predicted SEED Role

"Glutathione reductase (EC 1.8.1.7)" in subsystem Glutathione: Redox cycle (EC 1.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIV2 at UniProt or InterPro

Protein Sequence (462 amino acids)

>Atu1611 glutathione reductase (Agrobacterium fabrum C58)
MTAYDYDLFVIGGGSGGVRSGRVAASLGKRVGIAEEYRYGGTCVIRGCVPKKLFVYASQF
PEYFEDAEGFGWSVGERRFDWKKLIAAKDKEITRLEGLYRKGLENAKADIFDSRAELVDA
HTVKLTKTGETYTAERIVIAVGGTPNEHKALPGHELTISSNEAFDLEEPPKSILIAGGGY
IAVEFANIFHGLGVETTLIYRGKEILSRFDHDMRKGLHEAMEAKGIRIILEDIIEEVSKD
GAGGFVARTKQGSSLHVGLVMLALGRDPNTKGLGLENAGVKVDARGAIIVDDYSRTNVPS
IFALGDVTDRVQLTPVAIHEAMCFIETEYKNNPTKPDHELIATAVFSQPEIGTVGLSEEE
AGKKYRELEVYRAQFRPMKATLSGRQEKTIMKLIVNASDRRVVGVHILGHEAGEMAQLLG
ITLKAGCTKDDFDRTMAVHPTAAEELVTMYAPSYRVVNGERV