Protein Info for Atu1600 in Agrobacterium fabrum C58

Annotation: acyl carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 94 PF00550: PP-binding" amino acids 8 to 61 (54 residues), 41.4 bits, see alignment E=7.1e-15

Best Hits

Swiss-Prot: 100% identical to ACPXL_AGRFC: Acyl carrier protein AcpXL (acpXL) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 96% identity to ret:RHE_CH02478)

Predicted SEED Role

"Acyl carrier protein" in subsystem Fatty Acid Biosynthesis FASII or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or mycolic acid synthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UF02 at UniProt or InterPro

Protein Sequence (94 amino acids)

>Atu1600 acyl carrier protein (Agrobacterium fabrum C58)
MGVTATFDKVADIIAETSEIDRETITPESHTIDDLGIDSLDFLDIVFAIDKEFGIKIPLE
QWTQEVNEGKVSTEEYFVLKNLCAKIDELRAAKG