Protein Info for Atu1599 in Agrobacterium fabrum C58

Annotation: (3R)-Hydroxymyristoyl-(acyl carrier protein)- Dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 transmembrane" amino acids 48 to 73 (26 residues), see Phobius details PF07977: FabA" amino acids 4 to 122 (119 residues), 60.6 bits, see alignment E=6.7e-21

Best Hits

KEGG orthology group: K02372, 3R-hydroxymyristoyl ACP dehydrase [EC: 4.2.1.-] (inferred from 100% identity to atu:Atu1599)

Predicted SEED Role

"3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)" (EC 4.2.1.59)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-, 4.2.1.59

Use Curated BLAST to search for 4.2.1.- or 4.2.1.59

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIV8 at UniProt or InterPro

Protein Sequence (159 amino acids)

>Atu1599 (3R)-Hydroxymyristoyl-(acyl carrier protein)- Dehydratase (Agrobacterium fabrum C58)
MLLEYFQMIDKVESVDMATRTLKAQSVVPDHSPVFEGHFPGMPLVPGVLLIETMAQASGM
MVLAFSDFASMPFLMSVDGAKMRTFVEPGAVLDIEAVLEHDGSGFAVTKAKITSAGKKVC
DAQLKLRTMPFSEIPLGPIVKKRAEEVGLMAAIAADAQK