Protein Info for Atu1596 in Agrobacterium fabrum C58

Annotation: 3-oxoacyl-(acyl-carrier-protein) synthase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00109: ketoacyl-synt
  • amino acids 13 to 62 (50 residues), 24.4 bits, 2.1e-09
  • amino acids 151 to 259 (109 residues), 81.8 bits, E=6.5e-27
• PF02801: Ketoacyl-synt_C
  • amino acids 268 to 381 (114 residues), 107.2 bits, E=5.5e-35

Best Hits

KEGG orthology group: K09458, 3-oxoacyl-[acyl-carrier-protein] synthase II [EC: 2.3.1.179] (inferred from 100% identity to atu:Atu1596)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASII (EC 2.3.1.179)" (EC 2.3.1.179)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• palmitate biosynthesis III (28/29 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (18/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• biotin biosynthesis I (13/15 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• fatty acid biosynthesis initiation (mitochondria) (2/4 steps found)
• petroselinate biosynthesis (2/6 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (21/205 steps found)
• superpathway of mycolate biosynthesis (22/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.179

Use Curated BLAST to search for 2.3.1.179

Sequence Analysis Tools

See A9CIW0 at UniProt or InterPro

Protein Sequence (426 amino acids)

>Atu1596 3-oxoacyl-(acyl-carrier-protein) synthase II (Agrobacterium fabrum C58)
MTNFKDHLGRPIVAVTGMGIITSLGQGLADNWAALTSGKSGIHKITRFPTEGLSTRISGT
VDFIDIPVPNSVERSYAFARETTIEALAQAGISGDFDGPLFLAAPPIEPEWSARFELADR
SPPAAKPGDAYERFMTALRQRPDPAFQEAALFGAISERLSDRFGTRGLPVTLSTACASGA
TAIQLGVEAIRQGRTERALTVATDGSVSAEALIRFSLLSALSTQNDPPEKASKPFSKDRD
GFVIAEGAATLVLESLEAAVARGAKVLGIIKGAGEKADSFHRTRSSPDGGPAIATIRAAL
ADAGVAESDIGYINAHGTSTPENDKMEYGSMLAVFGEGLKNIPLSSNKSMIGHTLTAAGA
VEAVFSLQTMLTGTLPPTINYNNPDPTITLDVVPNVKRDAQVGAVLSNSFGFGGQNASLV
MTREPA