Protein Info for Atu1591 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 6 to 34 (29 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 120 (18 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 231 to 249 (19 residues), see Phobius details PF01925: TauE" amino acids 12 to 247 (236 residues), 166.7 bits, see alignment E=3.6e-53

Best Hits

Swiss-Prot: 70% identical to YCB9_SINSX: Probable membrane transporter protein ORF9 from Sinorhizobium sp.

KEGG orthology group: K07090, (no description) (inferred from 100% identity to atu:Atu1591)

Predicted SEED Role

"Putative membrane protein YfcA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CYX2 at UniProt or InterPro

Protein Sequence (267 amino acids)

>Atu1591 hypothetical protein (Agrobacterium fabrum C58)
MQDIALNVFIVLFCVAIFAGFIDSIAGGGGLITIPAMMIMGIAPLDTLGTNKLQAQFGSA
SATLAYARRGHVNLKEQLPMGLMAMAGGMLGALTAAFVPADLLRTIMPFLLITIALYFAL
KPQLSDIDSHRRITPFVFGLMVAPLIGFYDGVFGPGAGSFYMLAFVALAGFGMLKATAHT
KLLNLGSNFGGFVVFAMGGAVLWKLGLAMGLGQFIGAQVGSRFAMKNGAKIIRPLLVVSC
LAMATKLLVDASSAWSIATIWETIFPK