Protein Info for Atu1580 in Agrobacterium fabrum C58

Annotation: ABC transporter, nucleotide binding/ATPase protein (amino acid)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00005: ABC_tran" amino acids 33 to 181 (149 residues), 137.3 bits, see alignment E=5.4e-44 PF13304: AAA_21" amino acids 161 to 212 (52 residues), 28.3 bits, see alignment E=1.8e-10

Best Hits

Swiss-Prot: 91% identical to AAPP_RHIL3: General L-amino acid transport ATP-binding protein AapP (aapP) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K09972, general L-amino acid transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to atu:Atu1580)

MetaCyc: 59% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"ABC-type polar amino acid transport system, ATPase component"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIW5 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Atu1580 ABC transporter, nucleotide binding/ATPase protein (amino acid) (Agrobacterium fabrum C58)
MAENQAKKLAVSTTDVAIEITGMNKWYGDFHVLRDINLKVMKGERIVIAGPSGSGKSTMI
RCINRLEEHQSGSIQVDGIELTNDLKKIDEVRREVGMVFQHFNLFPHLTILENCTLAPIW
VRKMPKKEAEEVAMHYLKRVKIPEQAHKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPT
SALDPEMVKEVLDTMVSLAEDGMTMLCVTHEMGFARQVANRVIFMDQGQIVEQNSPAEFF
DNPQHERTRLFLSQILH