Protein Info for Atu1578 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (amino acid)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 91 to 118 (28 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 223 to 247 (25 residues), see Phobius details amino acids 267 to 286 (20 residues), see Phobius details amino acids 340 to 358 (19 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 89 to 152 (64 residues), 53.8 bits, see alignment E=1.1e-18 PF00528: BPD_transp_1" amino acids 109 to 393 (285 residues), 39.7 bits, see alignment E=2.2e-14

Best Hits

Swiss-Prot: 68% identical to AAPQ_RHIL3: General L-amino acid transport system permease protein AapQ (aapQ) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K09970, general L-amino acid transport system permease protein (inferred from 100% identity to atu:Atu1578)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIW7 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Atu1578 ABC transporter, membrane spanning protein (amino acid) (Agrobacterium fabrum C58)
MAGNAVSSQRSRAQSASSLIYDPRIRGIFYQVLTVVILTAFVWVIVTNTITNLQRSNISS
GFGFLDGRAGFDIGQSLIAYTSDSTYGRALIVGILNTIQVAFFGIIAASIIGFIVGIARL
SNNWLISKLAQAYVEIFRNIPPLLVIFFWYKGVISVLPQARDSLELPLGSYLNNRGFFFP
KPLWGEGTWLIPLAFLVAIVISFFVYRWAKARQEQTGQQFRTGITAALLIIGLPAATFLA
LGSPLTFDYPIAGRFNLSGGSVVAPEFMSLFLALSFYTASFIAEIVRGGIKAVAKGQTEA
ADALGLRSSTTTRLIVVPQAMRIIIPPLTSQFLNLTKNSSLAVAVGFADIVSVGGTILNQ
TGQAVEVVAIWLVIYLSLSLLTALVMNWFNAKMALVER