Protein Info for Atu1568 in Agrobacterium fabrum C58

Annotation: transcriptional regulator, TetR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 113 to 122 (10 residues), see Phobius details PF00440: TetR_N" amino acids 19 to 65 (47 residues), 56.3 bits, see alignment 2.2e-19 PF13972: TetR" amino acids 86 to 210 (125 residues), 99.7 bits, see alignment E=1.4e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1568)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIX3 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Atu1568 transcriptional regulator, TetR family (Agrobacterium fabrum C58)
MSNDAERPARARSSTRDRILDAALDLFNGRGPDRVTTAEIAEAVKINEGNLYYHFRTKEL
LVLALFARFEVDAVALVASVDRADEGAAETYAGFLRQWFSLVWNYRFLFRDLVGLLALAP
GLVEPVRTISAAMRLAVGDIIGRMQKAGLITIPESERDAVLTNLWIVSTYWAAYLALQEG
VSEFGPQQLEWGLRQVSSLFRPYLSADAIAALEALATSEA