Protein Info for Atu1567 in Agrobacterium fabrum C58

Annotation: glutathione-independent formaldehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 73% identical to FADH_PSEAE: Glutathione-independent formaldehyde dehydrogenase (fdhA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00148, glutathione-independent formaldehyde dehydrogenase [EC: 1.2.1.46] (inferred from 100% identity to atu:Atu1567)

Predicted SEED Role

"Threonine dehydrogenase and related Zn-dependent dehydrogenases" in subsystem Threonine degradation

MetaCyc Pathways

formaldehyde oxidation IV (thiol-independent) (1/1 steps found)
methanol oxidation to carbon dioxide (2/6 steps found)
superpathway of C1 compounds oxidation to CO₂ (5/12 steps found)

KEGG Metabolic Maps

Methane metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CYY9 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Atu1567 glutathione-independent formaldehyde dehydrogenase (Agrobacterium fabrum C58)
MDMSRNRGVVYLKPGQVEVRDIDDPKLEAPDGRRIEHGVILKVISTNICGSDQHMVRGRT
TAMPGLVLGHEITGEVIEKGIDVEMLQVGDIVSVPFNVACGRCRCCKSQDTGVCLTVNPS
RAGGAYGYVDMGGWIGGQARYVTIPYADFNLLKFPDRDKAMSKIRDLTMLSDILPTGFHG
AVKAGVGVGSTVYVAGAGPVGLAAAASARILGAAVVMVGDFNKDRLAHAARVGFEPVDLS
KGDRLGDMIAEIVGTNEVDSAIDAVGFEARGHSGGEQPAIVLNQMMEITRAAGSIGIPGL
YVTEDPGAVDNAAKQGALSLRFGLGWAKAQSFHTGQTPVLKYNRQLMQAILHDRLPIADI
VNAKIIALDDAVQGYESFDQGAATKFVLDPHGDLLKAA