Protein Info for Atu1562 in Agrobacterium fabrum C58

Annotation: protein-export membrane protein SECD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 857 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 372 to 393 (22 residues), see Phobius details amino acids 399 to 419 (21 residues), see Phobius details amino acids 425 to 445 (21 residues), see Phobius details amino acids 466 to 491 (26 residues), see Phobius details amino acids 498 to 525 (28 residues), see Phobius details amino acids 555 to 573 (19 residues), see Phobius details amino acids 670 to 691 (22 residues), see Phobius details amino acids 698 to 721 (24 residues), see Phobius details amino acids 727 to 747 (21 residues), see Phobius details amino acids 773 to 794 (22 residues), see Phobius details amino acids 801 to 826 (26 residues), see Phobius details PF07549: Sec_GG" amino acids 44 to 57 (14 residues), 13.5 bits, see alignment (E = 1.3e-05) amino acids 571 to 595 (25 residues), 37.1 bits, see alignment (E = 4.8e-13) TIGR01129: protein-export membrane protein SecD" amino acids 47 to 520 (474 residues), 489.6 bits, see alignment E=1.2e-150 PF21760: SecD_1st" amino acids 163 to 221 (59 residues), 93.5 bits, see alignment 1.3e-30 PF22599: SecDF_P1_head" amino acids 239 to 352 (114 residues), 155.8 bits, see alignment E=1.1e-49 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 284 to 513 (230 residues), 270.5 bits, see alignment E=1.8e-84 amino acids 627 to 817 (191 residues), 194.8 bits, see alignment E=2.5e-61 PF02355: SecD_SecF_C" amino acids 355 to 519 (165 residues), 68.7 bits, see alignment E=1.3e-22 amino acids 651 to 828 (178 residues), 224.5 bits, see alignment E=2.3e-70 PF03176: MMPL" amino acids 398 to 532 (135 residues), 26.8 bits, see alignment E=7.4e-10 TIGR00966: protein-export membrane protein SecF" amino acids 575 to 820 (246 residues), 275.6 bits, see alignment E=6.5e-86

Best Hits

KEGG orthology group: K12257, SecD/SecF fusion protein (inferred from 100% identity to atu:Atu1562)

Predicted SEED Role

"Protein-export membrane protein SecD (TC 3.A.5.1.1) / Protein-export membrane protein SecF (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CYZ3 at UniProt or InterPro

Protein Sequence (857 amino acids)

>Atu1562 protein-export membrane protein SECD (Agrobacterium fabrum C58)
MLHFSRWKTVFIWLLVLASVFIASPNLFSEKQLESMPAWYKDNKVTLGLDLQGGSHIMLK
IERSDIVKERLETIVGDVRTQLRDANIRYSGLTGNGQQIQVRISDPAQMEAAKTALRDLT
QPVSAGTLVGGSITEVTMNDGGDSLLRLNLTDEGIDYRLSSAVSQSIEVVRRRVDEVGTT
EPLIQRQGSDRIIVQVPGLQDPQRLKSLLNQTAKLSFRMVDTTMPAQDAMNGRPPATSEV
LYSQDDPPVPYLVERRALVSGDNLVDAQASFNQQTNEPVVTFRFDSRGAQRFAQATQQNV
GKPFAIVLDNQVISAPVIREPIIGGSGQISGSFSVQGANDLAVLLRAGALPATLTVVEER
TVGPSLGNDSITAGLTASAIGAVGVLIFMFVFYGFFGLLANIALIVNVVMLIAVLSVIGS
TLTLPGIAGIVLTIGMAVDSNVLIYERIREEVKSGKPLIQALDNGFTRAFATIIDANLTT
LIVASVLFYMGTGPVKGFAVTLAVGIITTVFTAYTLTAWMFGYWVRRSRPKHLPKGVRTA
MFDGRDIPFMRYRRVVFMITGVIMLACVGGFVAKGLNLGIDFQGGSVIEVRAKQGEADLA
DIRERLNQLNLGEIQAQNFGSPQDVLIRIQAQDGGENAEQSAITLVRGELEDKYDFRRVE
VVGPAVSGDLTVTSTIGVLLAMAAIMVYIWVRFEWQFALGAVISMVHDVVFTIGLFVFLG
IEFNLTSIAAILTIIGYSLNDTVVIYDRVRENLRRYKKMPLSMIIDVSLNQTLSRTILTG
LTVLLALLALYLFGGEVIRSFTFAMLFGVGIGVFSSVYIAAPVLIAFKLRPDSKDAEDEK
DDKKENNTGAIGGKPAV