Protein Info for Atu1547 in Agrobacterium fabrum C58

Annotation: magnesium transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 309 to 329 (21 residues), see Phobius details amino acids 335 to 354 (20 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details amino acids 411 to 436 (26 residues), see Phobius details amino acids 448 to 472 (25 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 50 to 471 (422 residues), 318.9 bits, see alignment E=2.6e-99 PF03448: MgtE_N" amino acids 57 to 157 (101 residues), 80.6 bits, see alignment E=1.7e-26 PF00571: CBS" amino acids 164 to 218 (55 residues), 16.7 bits, see alignment 1.2e-06 amino acids 225 to 279 (55 residues), 39.2 bits, see alignment 1.1e-13 PF01769: MgtE" amino acids 343 to 466 (124 residues), 121.5 bits, see alignment E=3.9e-39

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 100% identity to atu:Atu1547)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CZ03 at UniProt or InterPro

Protein Sequence (475 amino acids)

>Atu1547 magnesium transport protein (Agrobacterium fabrum C58)
MTDRDDDPVAPDDVKPAEALSDIYAEDGSVRSDFLAMVGAAIADRDLLFLRKNVARLHES
ELGDVLESILPEQRHALVRLLGSDFDMTALTEVDEGIRLDIVDQMSNEQIAAGIGELDSD
DAVYILEDLDDEDREDILSQLPFTERVRLMRALDYPESSAGRRMQTEFVAVPPFWTVGQT
IDYLREEEELPESFSQIFVIDPTFKLVGALDLDKVLRAKRQVKIETIMHETNHSIPAEMD
QEEAAQLFEQYDLLSAAVVDNNGRLVGVLTIDDVVDVIQEEAEEDLLRLGGVGDEELSDS
IFSTSRSRVPWLAVNLLTAFLSASVISLFDATIQQIIALAILMPAVAGMGGNAGSQTMTV
SVRALATKSLDIHNAARIIRREAGVGILNGMLFGCAIGIVAGVWFQDIHIGGIIATAMCL
NMLAAALAGILIPLVLDKFGADPAVSSAVFVTAVTDIVGFFAFLGIATWWYGISG