Protein Info for Atu1536 in Agrobacterium fabrum C58

Annotation: cytochrome C oxidase, FixO chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details PF02433: FixO" amino acids 7 to 231 (225 residues), 326.5 bits, see alignment E=3.8e-102 TIGR00781: cytochrome c oxidase, cbb3-type, subunit II" amino acids 8 to 238 (231 residues), 402.4 bits, see alignment E=3.2e-125

Best Hits

KEGG orthology group: K00405, cb-type cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 100% identity to atu:Atu1536)

MetaCyc: 72% identical to cytochrome cbb3 oxidase subunit II (Rhodobacter capsulatus)
CYTOCHROME-C-OXIDASE-RXN [EC: 7.1.1.9]

Predicted SEED Role

"Cytochrome c oxidase subunit CcoO (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIY7 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Atu1536 cytochrome C oxidase, FixO chain (Agrobacterium fabrum C58)
MSILDKHGVIERNATLLLVGSLLVVSIGGIVEIAPLFYLENTIEKVEGMRPYSPLELAGR
NIYIREGCYVCHSQMIRPFRDEVERYGHYSLAAESMYDHPFQWGSKRTGPDLARVGDRYS
NEWHVQHLANPRSVVPESIMPSYAFLKTTPLKITDVSMELKANRAVGVPYSDEMIEKSAT
DLHAQADPNADTSELLERYPKAKVGDFDGDPAKLTEMDALVAYLQMLGTLVDFSTYDDAA
GYR