Protein Info for Atu1534 in Agrobacterium fabrum C58

Annotation: cytochrome-c oxidase, FixP chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 32 to 54 (23 residues), see Phobius details TIGR00782: cytochrome c oxidase, cbb3-type, subunit III" amino acids 8 to 287 (280 residues), 382.6 bits, see alignment E=6e-119 PF14715: FixP_N" amino acids 11 to 57 (47 residues), 88.3 bits, see alignment 3.2e-29 PF13442: Cytochrome_CBB3" amino acids 111 to 192 (82 residues), 49.4 bits, see alignment E=7.2e-17 amino acids 205 to 280 (76 residues), 46.6 bits, see alignment E=5.4e-16 PF00034: Cytochrom_C" amino acids 113 to 195 (83 residues), 46.3 bits, see alignment E=1.3e-15 amino acids 205 to 275 (71 residues), 37.1 bits, see alignment E=9.4e-13

Best Hits

Swiss-Prot: 69% identical to FIXP_RHIME: Cbb3-type cytochrome c oxidase subunit FixP (fixP) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00406, cb-type cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 100% identity to atu:Atu1534)

MetaCyc: 47% identical to cytochrome cbb3 oxidase subunit III (Rhodobacter capsulatus)
CYTOCHROME-C-OXIDASE-RXN [EC: 7.1.1.9]

Predicted SEED Role

"Cytochrome c oxidase subunit CcoP (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIY8 at UniProt or InterPro

Protein Sequence (287 amino acids)

>Atu1534 cytochrome-c oxidase, FixP chain (Agrobacterium fabrum C58)
MSEKHIDEISGVETTGHEWDGIRELNNPMPRWWVWTFYFTILWAIGYTIAYPAWPLINGA
TQGLLGWSSRGEIAAEIADAKQSQSVYVDKIANSSLAEIQADPTLMQFALSGGAAAFKVN
CIQCHGSGAEGGQGYPNLNDDDWMWGGSVDDIYTTVKHGIRFADDADTRASEMPAFGDIL
KSDEIRAVAAYVVSLTGTPSNPALVEPGKQLFADNCASCHGEDAKGNREFGAPNLADAIW
LKAHGEEGIVAQIRSPKHGVMPAWGERLGDTTVKQLAIFVHSLGGGE