Protein Info for Atu1520 in Agrobacterium fabrum C58

Annotation: ABC transporter, nucleotide binding/ATPase protein (zinc)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF00005: ABC_tran" amino acids 29 to 156 (128 residues), 90.2 bits, see alignment E=9.7e-30

Best Hits

Swiss-Prot: 100% identical to ZNUC_AGRFC: Zinc import ATP-binding protein ZnuC (znuC) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K09817, zinc transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to atu:Atu1520)

Predicted SEED Role

"Zinc ABC transporter, ATP-binding protein ZnuC" in subsystem Transport of Zinc

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UF79 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Atu1520 ABC transporter, nucleotide binding/ATPase protein (zinc) (Agrobacterium fabrum C58)
MLHSAHKGNEILVSLANAGVQRNGRWLVRGVEFSVSKGEIVTLIGPNGSGKSTSAKMAIG
VAKPSEGKVSRKAGLRVGYVPQKLSVDWTMPLSVRRLMTLTGPLPAREIDAALNATGIAH
LANAEVQHLSGGEFQRALLARAIARKPDLLVLDEPVQGVDFSGEIALYDLIKNIRNSNDC
GILLISHDLHVVMAETDTVICLNGHVCCRGTPQAVSQSPEYMRLFGGTAAKALAVYSHHH
DHTHLPDGRVQHADGTVTDHCHPEDGHHHDEDGECGCGHDHGEHGDHAPDGLRQGERHV