Protein Info for Atu1515 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 TIGR00742: tRNA dihydrouridine synthase A" amino acids 13 to 326 (314 residues), 420.2 bits, see alignment E=3.1e-130 PF01207: Dus" amino acids 15 to 318 (304 residues), 260.3 bits, see alignment E=1.1e-81

Best Hits

Swiss-Prot: 54% identical to DUSA_SALTI: tRNA-dihydrouridine(20/20a) synthase (dusA) from Salmonella typhi

KEGG orthology group: K05539, tRNA-dihydrouridine synthase A [EC: 1.-.-.-] (inferred from 100% identity to atu:Atu1515)

MetaCyc: 54% identical to tRNA-dihydrouridine synthase A (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"tRNA dihydrouridine synthase A"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIZ5 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Atu1515 hypothetical protein (Agrobacterium fabrum C58)
MYRQALASGEKIFAVAPMIDWTDTRCRFLHRQLSKRALLFTEMIVADAIIHGQREKLLGY
HPQEHPVALQLGGSNPAKLAEAVRIAGDYGYDEINLNVGCPSDRVQSGTFGACLMREPEV
VAQCISAMKAVAAVPVTVKCRIGVDDQEPETVLPDFLARVVAAGADAVWVHARKAWLQGL
SPKENREVPPLDYDLVYRMKRDNPDVFIGINGGIADLDQAGEHLKYVDGVMLGRAAYHNT
SILADVDHRIHGEEALQYDWMALRDTMMAYAADYIATGGRLNHVTRHMVGLFQGMPGARR
FRQILSSDATRPGAGPEVIEAAFAAIDFNPMKELAG