Protein Info for Atu1512 in Agrobacterium fabrum C58

Annotation: single-strand DNA binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 TIGR00621: single-stranded DNA-binding protein" amino acids 3 to 173 (171 residues), 165.2 bits, see alignment E=8.1e-53 PF00436: SSB" amino acids 5 to 106 (102 residues), 127 bits, see alignment E=1.4e-41

Best Hits

Swiss-Prot: 100% identical to SSB_AGRFC: Single-stranded DNA-binding protein (ssb) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03111, single-strand DNA-binding protein (inferred from 100% identity to atu:Atu1512)

MetaCyc: 49% identical to ssDNA-binding protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UF87 at UniProt or InterPro

Protein Sequence (173 amino acids)

>Atu1512 single-strand DNA binding protein (Agrobacterium fabrum C58)
MAGSVNKVILIGNVGADPEIRRTQDGRPIANLRIATSETWRDRNSGERKEKTEWHTVVVF
NEGLCKVVEQYVKKGAKLYIEGQLQTRKWQDQTGNDRYSTEIVLQGFNSTLTMLDGRGEG
GGGRSGGGDFGGGNDYGSGGGYDQQSSPRGGSSRGGGQPSGGFSNDMDDDIPF