Protein Info for Atu1509 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 48 to 66 (19 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 125 to 165 (41 residues), see Phobius details PF04982: HPP" amino acids 51 to 171 (121 residues), 135.4 bits, see alignment E=1.2e-43 PF00571: CBS" amino acids 239 to 291 (53 residues), 50.4 bits, see alignment 2.3e-17 amino acids 321 to 375 (55 residues), 58.2 bits, see alignment 8.2e-20

Best Hits

KEGG orthology group: K07168, CBS domain-containing membrane protein (inferred from 100% identity to atu:Atu1509)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIZ7 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Atu1509 hypothetical protein (Agrobacterium fabrum C58)
MRSTLRRLIPDAAPVSNRERLRTATGAFFGILLTGLLGSFALRFDPTLPAMIAPMGASAV
LLFAVPSSPLAQPWSILCGNLVSAFVGVTVALLVQDPFLASALAISFAIAAMMALRCLHP
PSGAVALTAVLGGPVVHSLGYGFLLWPVAGNSLILLALALLYNNATGRAYPHGLKPGKAA
HGTTDPTPIQKIGFSSTDLDEVLKEYDEVLDIDRDELETILRKTELRSYRRRALHLDCAS
VMSRDVIGVAPDDSLRHAHALMHNHHFKALPVTNDKAEIVGIVTQTDFLEKASWRNGRPS
IGFLQRLRLILSGASAPNDTVKDIMTSPVKTVLPETSIEEAIIRFAEEGLHYLPVIDAKG
KMVGIVSQSDVMVAMLADKVAA