Protein Info for Atu1508 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 42 to 67 (26 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 113 to 138 (26 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details PF01914: MarC" amino acids 6 to 207 (202 residues), 185.1 bits, see alignment E=5.4e-59 TIGR00427: membrane protein, MarC family" amino acids 7 to 203 (197 residues), 172.7 bits, see alignment E=4.1e-55

Best Hits

Swiss-Prot: 38% identical to Y2111_ARCFU: UPF0056 membrane protein AF_2111 (AF_2111) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 100% identity to atu:Atu1508)

Predicted SEED Role

"Membrane protein, MarC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIZ8 at UniProt or InterPro

Protein Sequence (209 amino acids)

>Atu1508 hypothetical protein (Agrobacterium fabrum C58)
MASSETLINALTTLLVTLDPPGLAPVFLALTVGMTRDQRSQVALRGSIIAFGILAVFALF
GLAILNLLGISLGAFRIAGGLLLFWISFEMIFEKRQERKEKTSEIAITKDHLHNLAVFPL
ALPLIAGPGAISATVLLAGSMKTTVEMVVLILILAFAMALVYAALIVSERMDRFLGNTGR
AILTRLLGVLLAALSVQFVVDGIKSAFDF